PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009788319.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 330aa    MW: 38616 Da    PI: 8.3475
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009788319.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.92.3e-171052244
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     i+n++ r+ t+ kR++g+ KKA+ELS+LC+++ ++ii+++++
  XP_009788319.1 10 LIKNERSRNSTYQKRKKGLEKKANELSTLCQVKLCMIIYGPKD 52
                    59**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.0E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.096151IPR002100Transcription factor, MADS-box
CDDcd002669.20E-24285No hitNo description
SuperFamilySSF554551.57E-21291IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-8323IPR002100Transcription factor, MADS-box
PfamPF003195.6E-171152IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRRKIGMEL IKNERSRNST YQKRKKGLEK KANELSTLCQ VKLCMIIYGP KDSEPTIWPD  60
KDTIQSLIDS YRARSDDDQR LRTHDLSFYF RDLTRKVEIE SSKLRKKNFE AKYPTWDQLY  120
DNLSSDQLKQ LSALLGAKIE FMKQRLEFLK GTQTISLDDM HAMSFLGKQI TQPNTQCVMQ  180
SLVRKSSLQL EIIEQQQQQQ FVPPINFTET EIMQFGQHQM IRRDNHQSSG IPHCTATGYE  240
PHLAMLNTSG NIIENQQVCH RDLARDNNMM LSNVDQQPQP LCYFVPMVTP NNYFHQYHPM  300
LPNAAASYQM HASQREEYYE MGDFQLPNMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788319.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLM1CP541e-119M1CP54_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000716821e-119(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24572253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-21M-type_MADS family protein